PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462903980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 1718aa    MW: 191787 Da    PI: 5.124
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462903980genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.22.2e-16453857
               -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
               t++qle+Le+ ++ ++yps++ r eL+ k+gL++rq ++WF+ rR k++k
  462903980  4 TPYQLEVLESTYRAEQYPSEALRMELSVKIGLSDRQLQMWFCHRRLKDRK 53
               89**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.949154IPR001356Homeobox domain
SMARTSM003892.2E-9258IPR001356Homeobox domain
CDDcd000863.26E-12354No hitNo description
Gene3DG3DSA:1.10.10.604.4E-15353IPR009057Homeodomain-like
SuperFamilySSF466891.03E-13353IPR009057Homeodomain-like
PfamPF000463.7E-14453IPR001356Homeobox domain
SMARTSM005719.0E-17640699IPR018501DDT domain
PROSITE profilePS5082715.591640699IPR018501DDT domain
PfamPF027912.4E-16643696IPR018501DDT domain
PfamPF156121.2E-710161058IPR028942WHIM1 domain
PfamPF156138.0E-1311941265IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1718 aa     Download sequence    Send to blast
MMKTPYQLEV LESTYRAEQY PSEALRMELS VKIGLSDRQL QMWFCHRRLK DRKPPSKRQR  60
RDEEAALAPV MAPPSLLPLP AVPLASSDLM MGTPVPFEEP LHPIHLRRGA GRSSAMARIS  120
MPDIGRRYYE PPPVLFPPPT ASVHLTQSEL RQIRSVESQL GEPLREDGPV LGNAFDPLPP  180
GAFGAPIVPE QQKQPVRSYD AKIFSRHDPK LLKASAFLPT MEPPFVPTSF GGKRKSTVGN  240
PTIVQSHAGS RAVHEYQFLP EQPGDTYERA SRSHYYDTPV EASAFLPTME PPFVPTSFVG  300
KRKSTVGNPT SVQPHVGSRA VHEYQFLPEQ PSDTYERASQ SHYYDTPVEV SNSRISPLTS  360
GSQLLHGSDE AAPSFAYQGQ MSGSGILPQS DRSQTFSAVP GSYEMAQSSG NLNSVPVEGH  420
FGISEVAGFE NSLISSERGV YDEEETSRVD RKRKHNEEAK IAKEVEAHER RIRKELEKQD  480
MLNRKRDEQR RKEMEKLDRE RRKEEERLLR ERQREEERFQ REQRREHERM EKFLLQQSRR  540
AEKQRQKEEI RKQKEAARQK AANERATARR IAREYLELVE DERLELMELA AQSKGLPSML  600
HLDSNTLQQL DSFRGMLSQF PPQTVRLKVP FSIKPWSQSE DYVAKLLMVW KFLITFTDIL  660
GLSPVTLDEF VQSLHDYDSR LLGELHIALL KSIIKDIEDV ARTPSVALGV NPEGGHPQIV  720
EGAYAWGFNI RSWQRHLNLL TWPEILRQFA LSAGFGPQLK KRKVEEAYYR NDNEGHDGED  780
VISTLRSGSA AVNAAALMKE RGYTHRRRSR HRLTPGTVKF AAFHEVMVSQ YWKLQKKSRN  840
LDIAAALSRD TKLFERTAPS TYCVKSPYRK DPTDSEAVLS AAREKIRAFQ NVLSDSEAEK  900
EADDAERDED SEADDADEDI DGDDVTTVVG GDKDPLLAVK AQDGVPSTAT AGGIKAEANS  960
VGDVLNSQSS FTKSATAAPL STACTSGDSP LGASSKNHEA IPGDSEDTQI DESNQVEPWL  1020
QALAEGDYCE LSVEERLNAL FALVGVATEG NSIRAVLEER LELANALKKQ MWAEAQLDKR  1080
RFKEEFANRM QCNSYMSLKA DINHENNAAD GTKTPGFNAD KENDGNVGAI NNYEMLGQHS  1140
QGNDGSVSYE RNGASQEISA TPDASAIQHA YADKTRSQLK LYIGHRAEQL YVYRSLPLGQ  1200
DRRRNRYWQF TTSASSNDPG SGRIFFESID GHWRVIDSEE AFDSLVSSLD TRGSRESQLH  1260
SMLQMIEATF KEAVKRSAAI EQSFGRNIKN GATDMIRANF CSEFGSPSSA SDSTKASIPS  1320
EALQSFWTDV CRKSWGVKLY STKSVGEMFQ LLTLLESAIR RDFLSSDFET TSECLNTNSQ  1380
DTASQNPVGL AGSATVLPWI PDTTAAVMLR MLDLDAAILY IQNQKMERDG GDFMKLPSRY  1440
TVGKNTQEPA PLERTGFDLY DGRWLPSSGR RGRGRGSRGG GRGGRGRSRG GRVPRGISSS  1500
SRIEFKDDTV MHEKVPRKNA RRGRTRGRGR GRGRRTVRPR QPSESRGRSI PKANLLGSFS  1560
MLSSSKPATV EPPRSSGADE WGLETRIPYI EGDENCSGSE SDRSEDNEEN GQPMDVEYEQ  1620
QVPDYSVGYS GVSRPHELMP ATDRETTDEE DEDAEGDGDG DGDDYVEEDD ADNADDDIDA  1680
EMEEDDEIGD EGDGDHGGDG VEMDEDEGGT SYSSDYSE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
115231533RTRGRGRGRGR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969494.10.0PREDICTED: uncharacterized protein LOC101761385 isoform X1
TrEMBLC5XG210.0C5XG21_SORBI; Putative uncharacterized protein Sb03g030770
STRINGSb03g030770.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22833352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.20.0Homeodomain-like transcriptional regulator